PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009596-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family bHLH
Protein Properties Length: 181aa    MW: 20637.7 Da    PI: 9.9572
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009596-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH38.42.3e-121261455
                   HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
            HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                     + +Er+RR+++++ ++eL +l+P+    +++ +s  + L +A +YIk+Lq
  NNU_009596-RA 12 DRKTVERNRRNHMKNLYSELNSLIPNH--SSKETMSLPDQLNEAANYIKKLQ 61
                   56889*********************7..15555*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.379860IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.24E-8865No hitNo description
SuperFamilySSF474594.32E-14975IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.4E-141079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.4E-81361IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.6E-51466IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0050832Biological Processdefense response to fungus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MESHPNASSK TDRKTVERNR RNHMKNLYSE LNSLIPNHSS KETMSLPDQL NEAANYIKKL  60
QRKLERMKEK KENLMGINKL SRSISSGMMV GVKSPHIEIH DMGSALHVVL TSGLDQQFMF  120
YEVVRLLHEE GAQIVNANFS IIDDMIFHTV HSEIGESMHG FGAARISRRL KKFVSEFVNA  180
S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260225.11e-131PREDICTED: transcription factor bHLH36-like
TrEMBLA5C0F42e-81A5C0F4_VITVI; Putative uncharacterized protein
STRINGPOPTR_0011s05320.13e-73(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.11e-51bHLH family protein